PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g25180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 861aa    MW: 96100.6 Da    PI: 6.7966
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g25180genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.51.1e-22164265199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +++el+v
  Tp2g25180 164 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRV 260
                99*****************************7333.34459************************************************..449999*** PP

                EEE-S CS
         B3  95 kvfrk 99 
                +v+r+
  Tp2g25180 261 GVRRA 265
                **996 PP

2Auxin_resp120.81e-39290372183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW +SkWrsLk
   Tp2g25180 290 AWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPTRWAKSKWRSLK 372
                 89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-40160279IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.66E-40161293IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-20162264No hitNo description
PROSITE profilePS5086311.42164266IPR003340B3 DNA binding domain
PfamPF023621.5E-20164265IPR003340B3 DNA binding domain
SMARTSM010194.1E-22164266IPR003340B3 DNA binding domain
PfamPF065077.8E-37290372IPR010525Auxin response factor
PfamPF023093.9E-10725820IPR033389AUX/IAA domain
SuperFamilySSF542774.17E-12734812No hitNo description
PROSITE profilePS5174524.555735817IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MASSEVSMKG NRGGENFSSA GYSDPKETRN ISVAGEGQKT HSNRSVAVER VVDPEAALYR  60
ELWHACAGPL VTVPRQDDRV FYFPQGHIEQ VEASTNQAAE QQMPLYDLPS KLLCRVINVD  120
LKAEADTDEV YAQITLLPEP NQDENAIEKE APPPPPLRFQ VHSFCKTLTA SDTSTHGGFS  180
VLRRHADECL PPLDMSRQPP TQELVAKDLH ANEWRFRHIF RGQPRRHLLQ SGWSVFVSSK  240
RLVAGDAFIF LRGENGELRV GVRRAMRQQG NVPSSVISSH SMHLGVLATA WHAISTGTMF  300
TVYYKPRTSP SEFIVPFDQY MESVKNNYSI GMRFKMRFEG EEAPEQRFTG TIVGIEDSDP  360
TRWAKSKWRS LKVRWDETSS IPRPDRVSPW KIEPALAPPA LSPLPMPRPK RPRSNMAPSS  420
PDSSMLIREG SSKANMDPLP ASGLSRVLQG QEYPTLRTKH TESVECDAPE NSVVWQSSAD  480
DDKVDVVSAS RRYENWMSSG RHEPTYTDLL SGFGANIDPS HGHQIPFYDH SSSPSVAAKK  540
ILSDQDGKFD YLANQWQMMH SGLSLKLHES PRIPAASDAC FQGRGNAKYG EYPVFHALTT  600
ETAGGNWPIR PRALNYFEEV VHAQVQAQAQ AQAREHVTKR PAVVPEETVK SRDGNCRLFG  660
IPLVNNVNGT DSTMSQRNNL NEITGLTQIA SPKVQDLSDQ SKGSKSANDH REQGRPFQAN  720
HPHPKDIHTK TNSSRSCTKV HKQGIALGRS VDLSKFQNYE ELIAELDRLF EFNGELSAPK  780
KDWLIVYTDD ENDMMLVGDD PWQEFCCMVR KIYIYTKEEV RKMNPGTLSC RSEEEAVIGE  840
GSDAKDAKSA SNPSLSSAGN S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1805739418354Auxin response factor 1
4ldw_A1e-1805739418354Auxin response factor 1
4ldw_B1e-1805739418354Auxin response factor 1
4ldx_A1e-1805739418354Auxin response factor 1
4ldx_B1e-1805739418354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794610.0JN979461.1 Brassica rapa subsp. pekinensis auxin response factor 2-3 (ARF2-3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394444.10.0hypothetical protein EUTSA_v10003641mg
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLV4K1E70.0V4K1E7_EUTSA; Auxin response factor
STRINGAT5G62000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2